Lineage for d2i2wa_ (2i2w A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515496Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2515497Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2515715Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2515716Protein automated matches [190547] (16 species)
    not a true protein
  7. 2515770Species Escherichia coli [TaxId:562] [226782] (2 PDB entries)
  8. 2515771Domain d2i2wa_: 2i2w A: [204691]
    automated match to d2xblb_
    complexed with gol

Details for d2i2wa_

PDB Entry: 2i2w (more details), 1.95 Å

PDB Description: Crystal Structure of Escherichia Coli Phosphoheptose Isomerase
PDB Compounds: (A:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2i2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2wa_ c.80.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
myqdlirnelneaaetlanflkddanihaiqraavlladsfkaggkvlscgnggshcdam
hfaeeltgryrenrpgypaiaisdvshiscvgndfgfndifsryveavgregdvllgist
sgnsanvikaiaaarekgmkvitltgkdggkmagtadieirvphfgyadriqeihikvih
iliqliekemvk

SCOPe Domain Coordinates for d2i2wa_:

Click to download the PDB-style file with coordinates for d2i2wa_.
(The format of our PDB-style files is described here.)

Timeline for d2i2wa_: