Lineage for d2gw5a2 (2gw5 A:98-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031930Protein automated matches [190803] (2 species)
    not a true protein
  7. 2031931Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)
  8. 2031944Domain d2gw5a2: 2gw5 A:98-198 [204472]
    Other proteins in same PDB: d2gw5a1
    automated match to d1g0xa2
    complexed with ipa

Details for d2gw5a2

PDB Entry: 2gw5 (more details), 1.8 Å

PDB Description: crystal structure of lir-2 (ilt4) at 1.8 : differences from lir-1 (ilt2) in regions implicated in the binding of the cytomegalovirus class i mhc homolog ul18
PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 2 precursor

SCOPe Domain Sequences for d2gw5a2:

Sequence, based on SEQRES records: (download)

>d2gw5a2 b.1.1.4 (A:98-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckegedehpqclnsqphargssra
ifsvgpvspnrrwshrcygydlnspyvwsspsdllellvpg

Sequence, based on observed residues (ATOM records): (download)

>d2gw5a2 b.1.1.4 (A:98-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckeqclnsqphargssraifsvgp
vspnrrwshrcygydlnspyvwsspsdllellvpg

SCOPe Domain Coordinates for d2gw5a2:

Click to download the PDB-style file with coordinates for d2gw5a2.
(The format of our PDB-style files is described here.)

Timeline for d2gw5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gw5a1