SCOPe 2.08: Domain d2gw5a2: 2gw5 A:98-198

Lineage for d2gw5a2 (2gw5 A:98-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d2gw5a2: 2gw5 A:98-198 [204472]
   Other proteins in same PDB: d2gw5a1
   automated match to d1g0xa2
   complexed with ipa

Details for d2gw5a2

PDB Entry: 2gw5, 1.8 Å

PDB Description: crystal structure of lir-2 (ilt4) at 1.8 : differences from lir-1 (ilt2) in regions implicated in the binding of the cytomegalovirus class i mhc homolog ul18

PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 2 precursor

SCOPe Domain Sequences for d2gw5a2:

Sequence, based on SEQRES records:

>d2gw5a2 b.1.1.4 (A:98-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckegedehpqclnsqphargssra
ifsvgpvspnrrwshrcygydlnspyvwsspsdllellvpg

Sequence, based on observed residues (ATOM records):

>d2gw5a2 b.1.1.4 (A:98-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckeqclnsqphargssraifsvgp
vspnrrwshrcygydlnspyvwsspsdllellvpg

Timeline for d2gw5a2:

• d2gw5a2 first appeared in SCOPe 2.03
  
• d2gw5a2 appears in SCOPe 2.07