Lineage for d2gqda1 (2gqd A:4-252)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1626715Family c.95.1.1: Thiolase-related [53902] (9 proteins)
  6. 1626874Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 1626905Species Staphylococcus aureus [TaxId:1280] [225072] (1 PDB entry)
  8. 1626906Domain d2gqda1: 2gqd A:4-252 [204445]
    automated match to d1ox0a1

Details for d2gqda1

PDB Entry: 2gqd (more details), 2.3 Å

PDB Description: the crystal structure of b-ketoacyl-acp synthase ii (fabf) from staphylococcus aureus
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gqda1 c.95.1.1 (A:4-252) Beta-ketoacyl-ACP synthase II {Staphylococcus aureus [TaxId: 1280]}
nkrvvitgmgalspigndvkttwenalkgvngidkitridtepysvhlagelknfniedh
idkkearrmdrftqyaivaareavkdaqldinentadrigvwigsgiggmetfeiahkql
mdkgprrvspffvpmlipdmatgqvsidlgakgpngatvtacatgtnsigeafkivqrgd
adamitggteapithmaiagfsasralstnddietacrpfqegrdgfvmgegagilvies
lesaqarga

SCOPe Domain Coordinates for d2gqda1:

Click to download the PDB-style file with coordinates for d2gqda1.
(The format of our PDB-style files is described here.)

Timeline for d2gqda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gqda2