SCOPe 2.07: Domain d2gqda1: 2gqd A:4-252

Lineage for d2gqda1 (2gqd A:4-252)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (10 protein domains)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)

7. Species Staphylococcus aureus [TaxId:1280] [225072] (1 PDB entry)

8. Domain d2gqda1: 2gqd A:4-252 [204445]
   automated match to d1ox0a1

Details for d2gqda1

PDB Entry: 2gqd, 2.3 Å

PDB Description: the crystal structure of b-ketoacyl-acp synthase ii (fabf) from staphylococcus aureus

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d2gqda1:

Sequence; same for both SEQRES and ATOM records:

>d2gqda1 c.95.1.1 (A:4-252) Beta-ketoacyl-ACP synthase II {Staphylococcus aureus [TaxId: 1280]}
nkrvvitgmgalspigndvkttwenalkgvngidkitridtepysvhlagelknfniedh
idkkearrmdrftqyaivaareavkdaqldinentadrigvwigsgiggmetfeiahkql
mdkgprrvspffvpmlipdmatgqvsidlgakgpngatvtacatgtnsigeafkivqrgd
adamitggteapithmaiagfsasralstnddietacrpfqegrdgfvmgegagilvies
lesaqarga

Timeline for d2gqda1:

• d2gqda1 first appeared in SCOPe 2.03
  
• d2gqda1 appears in SCOPe 2.06