| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species) |
| Species Staphylococcus aureus [TaxId:1280] [419492] (1 PDB entry) |
| Domain d2gqda1: 2gqd A:4-252 [204445] Other proteins in same PDB: d2gqda2, d2gqdb2 automated match to d1ox0a1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2gqd (more details), 2.3 Å
SCOPe Domain Sequences for d2gqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gqda1 c.95.1.1 (A:4-252) Beta-ketoacyl-ACP synthase II, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
nkrvvitgmgalspigndvkttwenalkgvngidkitridtepysvhlagelknfniedh
idkkearrmdrftqyaivaareavkdaqldinentadrigvwigsgiggmetfeiahkql
mdkgprrvspffvpmlipdmatgqvsidlgakgpngatvtacatgtnsigeafkivqrgd
adamitggteapithmaiagfsasralstnddietacrpfqegrdgfvmgegagilvies
lesaqarga
Timeline for d2gqda1: