SCOPe 2.08: Domain d2gpyb1: 2gpy B:8-227

Lineage for d2gpyb1 (2gpy B:8-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [225075] (1 PDB entry)

8. Domain d2gpyb1: 2gpy B:8-227 [204443]
   Other proteins in same PDB: d2gpyb2
   automated match to d3cbga_
   complexed with mg, zn

Details for d2gpyb1

PDB Entry: 2gpy, 1.9 Å

PDB Description: crystal structure of putative o-methyltransferase from bacillus halodurans

PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d2gpyb1:

Sequence, based on SEQRES records:

>d2gpyb1 c.66.1.0 (B:8-227) automated matches {Bacillus halodurans [TaxId: 272558]}
lkhylekqipardqyieqmereaheqqvpimdllgmesllhllkmaaparileigtaigy
sairmaqalpeativsierderryeeahkhvkalglesriellfgdalqlgeklelyplf
dvlfidaakgqyrrffdmyspmvrpgglilsdnvlfrglvaetdiehkrhkqlatkidty
nqwllehpqydtrifpvgdgiaisikretkgdtddekaeg

Sequence, based on observed residues (ATOM records):

>d2gpyb1 c.66.1.0 (B:8-227) automated matches {Bacillus halodurans [TaxId: 272558]}
lkhylekqipardqyieqmereaheqqvpimdllgmesllhllkmaaparileigtaigy
sairmaqalpeativsierderryeeahkhvkalglesriellfgdalqlgeklelyplf
dvlfidaakgqyrrffdmyspmvrpgglilsdnvlfnqwllehpqydtrifpvgdgiais
ikreeg

Timeline for d2gpyb1:

• d2gpyb1 first appeared in SCOPe 2.03, called d2gpyb_
  
• d2gpyb1 appears in SCOPe 2.07