Lineage for d3cbga_ (3cbg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895048Species Synechocystis sp. [TaxId:1148] [195466] (1 PDB entry)
  8. 2895049Domain d3cbga_: 3cbg A: [195467]
    automated match to d3tr6a_
    complexed with 4fe, fer, mg, sah

Details for d3cbga_

PDB Entry: 3cbg (more details), 2 Å

PDB Description: functional and structural characterization of a cationdependent o- methyltransferase from the cyanobacterium synechocystis sp. strain pcc 6803
PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d3cbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbga_ c.66.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
kgitgfdpslysylqsisaddsfylaqlrretahlpgapmqispeqaqflgllisltgak
qvleigvfrgysalamalqlppdgqiiacdqdpnataiakkywqkagvaekislrlgpal
atleqltqgkplpefdlifidadkrnypryyeiglnllrrgglmvidnvlwhgkvtevdp
qeaqtqvlqqfnrdlaqdervrisviplgdgmtlalkk

SCOPe Domain Coordinates for d3cbga_:

Click to download the PDB-style file with coordinates for d3cbga_.
(The format of our PDB-style files is described here.)

Timeline for d3cbga_: