Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [225075] (1 PDB entry) |
Domain d2gpyb1: 2gpy B:8-227 [204443] Other proteins in same PDB: d2gpyb2 automated match to d3cbga_ complexed with mg, zn |
PDB Entry: 2gpy (more details), 1.9 Å
SCOPe Domain Sequences for d2gpyb1:
Sequence, based on SEQRES records: (download)
>d2gpyb1 c.66.1.0 (B:8-227) automated matches {Bacillus halodurans [TaxId: 272558]} lkhylekqipardqyieqmereaheqqvpimdllgmesllhllkmaaparileigtaigy sairmaqalpeativsierderryeeahkhvkalglesriellfgdalqlgeklelyplf dvlfidaakgqyrrffdmyspmvrpgglilsdnvlfrglvaetdiehkrhkqlatkidty nqwllehpqydtrifpvgdgiaisikretkgdtddekaeg
>d2gpyb1 c.66.1.0 (B:8-227) automated matches {Bacillus halodurans [TaxId: 272558]} lkhylekqipardqyieqmereaheqqvpimdllgmesllhllkmaaparileigtaigy sairmaqalpeativsierderryeeahkhvkalglesriellfgdalqlgeklelyplf dvlfidaakgqyrrffdmyspmvrpgglilsdnvlfnqwllehpqydtrifpvgdgiais ikreeg
Timeline for d2gpyb1: