Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (25 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [225304] (1 PDB entry) |
Domain d2gpca2: 2gpc A:85-194 [204439] Other proteins in same PDB: d2gpca1, d2gpcb1 automated match to d2nyba2 complexed with fe2, mg |
PDB Entry: 2gpc (more details), 1.9 Å
SCOPe Domain Sequences for d2gpca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpca2 d.44.1.0 (A:85-194) automated matches {Trypanosoma cruzi [TaxId: 5693]} ngggeptgkvadeinasfgsfakfkeeftnvavghfgsgwawlvkdtnsgklkvyqthda gcpltepnlkplltcdvwehayyvdykndraayvqtfwnvvnwknverql
Timeline for d2gpca2: