SCOPe 2.03: Domain d2gpca2: 2gpc A:85-194

Lineage for d2gpca2 (2gpc A:85-194)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [225304] (1 PDB entry)

8. Domain d2gpca2: 2gpc A:85-194 [204439]
   Other proteins in same PDB: d2gpca1, d2gpcb1
   automated match to d2nyba2
   complexed with fe2, mg

Details for d2gpca2

PDB Entry: 2gpc, 1.9 Å

PDB Description: The crystal structure of the enzyme Fe-superoxide dismutase from Trypanosoma cruzi

PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d2gpca2:

Sequence; same for both SEQRES and ATOM records:

>d2gpca2 d.44.1.0 (A:85-194) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ngggeptgkvadeinasfgsfakfkeeftnvavghfgsgwawlvkdtnsgklkvyqthda
gcpltepnlkplltcdvwehayyvdykndraayvqtfwnvvnwknverql

Timeline for d2gpca2:

• d2gpca2 is new in SCOPe 2.03-stable
  
• d2gpca2 appears in SCOPe 2.04
  
• d2gpca2 appears in the current release, SCOPe 2.08