Lineage for d2gpcb2 (2gpc B:85-194)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411726Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1411727Protein automated matches [226860] (25 species)
    not a true protein
  7. 1411844Species Trypanosoma cruzi [TaxId:5693] [225304] (1 PDB entry)
  8. 1411846Domain d2gpcb2: 2gpc B:85-194 [204441]
    Other proteins in same PDB: d2gpca1, d2gpcb1
    automated match to d2nyba2
    complexed with fe2, mg

Details for d2gpcb2

PDB Entry: 2gpc (more details), 1.9 Å

PDB Description: The crystal structure of the enzyme Fe-superoxide dismutase from Trypanosoma cruzi
PDB Compounds: (B:) iron superoxide dismutase

SCOPe Domain Sequences for d2gpcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpcb2 d.44.1.0 (B:85-194) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ngggeptgkvadeinasfgsfakfkeeftnvavghfgsgwawlvkdtnsgklkvyqthda
gcpltepnlkplltcdvwehayyvdykndraayvqtfwnvvnwknverql

SCOPe Domain Coordinates for d2gpcb2:

Click to download the PDB-style file with coordinates for d2gpcb2.
(The format of our PDB-style files is described here.)

Timeline for d2gpcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gpcb1