![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (26 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:5693] [225303] (1 PDB entry) |
![]() | Domain d2gpcb1: 2gpc B:1-84 [204440] Other proteins in same PDB: d2gpca2, d2gpcb2 automated match to d1isca1 complexed with fe2, mg |
PDB Entry: 2gpc (more details), 1.9 Å
SCOPe Domain Sequences for d2gpcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpcb1 a.2.11.0 (B:1-84) automated matches {Trypanosoma cruzi [TaxId: 5693]} mfsipplpwgydglaakglskqqvtlhydkhhqgyvtklnaaaqtnsalatksieeiirt ekgpifnlaaqifnhtfywesmcp
Timeline for d2gpcb1: