Lineage for d1f3rb1 (1f3r B:1-123)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782601Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 782630Domain d1f3rb1: 1f3r B:1-123 [20416]
    Other proteins in same PDB: d1f3rb2
    part of scFv MAB198 against the main immunogenic region of the human muscle acetylcholine receptor; order: VH-linker-VL
    mutant

Details for d1f3rb1

PDB Entry: 1f3r (more details)

PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor
PDB Compounds: (B:) fv antibody fragment

SCOP Domain Sequences for d1f3rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3rb1 b.1.1.1 (B:1-123) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
vss

SCOP Domain Coordinates for d1f3rb1:

Click to download the PDB-style file with coordinates for d1f3rb1.
(The format of our PDB-style files is described here.)

Timeline for d1f3rb1: