| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species scFv MAB198, (rat), kappa L chain [48887] (1 PDB entry) |
| Domain d1f3rb1: 1f3r B:1-123 [20416] |
PDB Entry: 1f3r (more details)
SCOP Domain Sequences for d1f3rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3rb1 b.1.1.1 (B:1-123) Immunoglobulin (variable domains of L and H chains) {scFv MAB198, (rat), kappa L chain}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
vss
Timeline for d1f3rb1: