| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (203 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries) |
| Domain d2e37d1: 2e37 D:1-141 [204064] Other proteins in same PDB: d2e37a2, d2e37b2, d2e37c2, d2e37d2, d2e37e2, d2e37f2, d2e37g2, d2e37h2 automated match to d1llda1 complexed with nad, so4 |
PDB Entry: 2e37 (more details), 2.3 Å
SCOPe Domain Sequences for d2e37d1:
Sequence, based on SEQRES records: (download)
>d2e37d1 c.2.1.0 (D:1-141) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg
>d2e37d1 c.2.1.0 (D:1-141) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvarlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqva
yrlsglppgrvvgsg
Timeline for d2e37d1: