SCOPe 2.05: Domain d2e37e1: 2e37 E:1-141

Lineage for d2e37e1 (2e37 E:1-141)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)

8. Domain d2e37e1: 2e37 E:1-141 [204066]
   Other proteins in same PDB: d2e37a2, d2e37b2, d2e37c2, d2e37d2, d2e37e2, d2e37f2, d2e37g2, d2e37h2
   automated match to d1llda1
   complexed with nad, so4

Details for d2e37e1

PDB Entry: 2e37, 2.3 Å

PDB Description: Structure of TT0471 protein from Thermus thermophilus

PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2e37e1:

Sequence; same for both SEQRES and ATOM records:

>d2e37e1 c.2.1.0 (E:1-141) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Timeline for d2e37e1:

• d2e37e1 first appeared in SCOPe 2.03
  
• d2e37e1 appears in SCOPe 2.04
  
• d2e37e1 appears in SCOPe 2.06
  
• d2e37e1 appears in the current release, SCOPe 2.08