Lineage for d2d5ha1 (2d5h A:6-248)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424800Species Soybean (Glycine max) [TaxId:3847] [225175] (2 PDB entries)
  8. 2424805Domain d2d5ha1: 2d5h A:6-248 [203926]
    automated match to d1fxza1
    complexed with co3, mg

Details for d2d5ha1

PDB Entry: 2d5h (more details), 2.8 Å

PDB Description: Crystal Structure of Recombinant Soybean Proglycinin A3B4 subunit, its Comparison with Mature Glycinin A3B4 subunit, Responsible for Hexamer Assembly
PDB Compounds: (A:) glycinin A3B4 subunit

SCOPe Domain Sequences for d2d5ha1:

Sequence, based on SEQRES records: (download)

>d2d5ha1 b.82.1.0 (A:6-248) automated matches {Soybean (Glycine max) [TaxId: 3847]}
fnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspy
pqmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegdvlvi
ppgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqqqqks
hggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtveggls
vis

Sequence, based on observed residues (ATOM records): (download)

>d2d5ha1 b.82.1.0 (A:6-248) automated matches {Soybean (Glycine max) [TaxId: 3847]}
fnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspy
pqmiivvqgkgaigfafpgcpetfqdshqkirhfnegdvlvippgvpywtyntgdepvva
islldtsnfnnqldqnprvfylagnpdiehpetmqeeggsvlsgfskhflaqsfntnedt
aeklrspdderkqivtvegglsvis

SCOPe Domain Coordinates for d2d5ha1:

Click to download the PDB-style file with coordinates for d2d5ha1.
(The format of our PDB-style files is described here.)

Timeline for d2d5ha1: