Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (15 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [225175] (2 PDB entries) |
Domain d2d5ha1: 2d5h A:6-248 [203926] automated match to d1fxza1 complexed with co3, mg |
PDB Entry: 2d5h (more details), 2.8 Å
SCOPe Domain Sequences for d2d5ha1:
Sequence, based on SEQRES records: (download)
>d2d5ha1 b.82.1.0 (A:6-248) automated matches {Soybean (Glycine max) [TaxId: 3847]} fnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspy pqmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegdvlvi ppgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqqqqks hggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtveggls vis
>d2d5ha1 b.82.1.0 (A:6-248) automated matches {Soybean (Glycine max) [TaxId: 3847]} fnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspy pqmiivvqgkgaigfafpgcpetfqdshqkirhfnegdvlvippgvpywtyntgdepvva islldtsnfnnqldqnprvfylagnpdiehpetmqeeggsvlsgfskhflaqsfntnedt aeklrspdderkqivtvegglsvis
Timeline for d2d5ha1: