SCOPe 2.08: Domain d2c1uc2: 2c1u C:181-338

Lineage for d2c1uc2 (2c1u C:181-338)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Paracoccus pantotrophus [TaxId:82367] [187503] (3 PDB entries)

8. Domain d2c1uc2: 2c1u C:181-338 [203696]
   automated match to d1nmla2
   complexed with ca, hec

Details for d2c1uc2

PDB Entry: 2c1u, 1.95 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - oxidised form

PDB Compounds: (C:) di-haem cytochrome c peroxidase

SCOPe Domain Sequences for d2c1uc2:

Sequence; same for both SEQRES and ATOM records:

>d2c1uc2 a.3.1.0 (C:181-338) automated matches {Paracoccus pantotrophus [TaxId: 82367]}
nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
qqaeditaflgtltgeqpvidhpilpvrtgttplptpm

Timeline for d2c1uc2:

• d2c1uc2 first appeared in SCOPe 2.03
  
• d2c1uc2 appears in SCOPe 2.07