PDB entry 2c1u

View 2c1u on RCSB PDB site
Description: crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - oxidised form
Class: oxidoreductase
Keywords: electron transport, heme, oxidoreductase, periplasmic, peroxidase
Deposited on 2005-09-21, released 2006-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: di-haem cytochrome c peroxidase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1U (Start-337)
    Domains in SCOPe 2.07: d2c1ua1, d2c1ua2
  • Chain 'B':
    Compound: di-haem cytochrome c peroxidase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1U (Start-337)
    Domains in SCOPe 2.07: d2c1ub1, d2c1ub2
  • Chain 'C':
    Compound: di-haem cytochrome c peroxidase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1U (Start-337)
    Domains in SCOPe 2.07: d2c1uc1, d2c1uc2
  • Chain 'D':
    Compound: di-haem cytochrome c peroxidase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1U (Start-337)
    Domains in SCOPe 2.07: d2c1ud1, d2c1ud2
  • Heterogens: HEC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1uA (A:)
    eteaidngalreeakgvfeaipekmtaikqtednpegvpltaekielgkvlffdprmsss
    gliscqtchnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqak
    gpvqagvemsntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitp
    nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
    agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
    qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1uA (A:)
    aidngalreeakgvfeaipekmtaikqtegvpltaekielgkvlffdprmsssgliscqt
    chnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqakgpvqagv
    sntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitpnsafdrfla
    gddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlpagdtgrfev
    trttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltdqqaeditaf
    lgtltgeqpvidhpilpvrtgttplptpm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c1uB (B:)
    eteaidngalreeakgvfeaipekmtaikqtednpegvpltaekielgkvlffdprmsss
    gliscqtchnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqak
    gpvqagvemsntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitp
    nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
    agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
    qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1uB (B:)
    aidngalreeakgvfeaipekmtaikqtpegvpltaekielgkvlffdprmsssgliscq
    tchnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqakgpvqag
    vsntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitpnsafdrfl
    agddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgadtgrfevtrttd
    deyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltdqqaeditaflgtlt
    geqpvidhpilpvrtgttplptpm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c1uC (C:)
    eteaidngalreeakgvfeaipekmtaikqtednpegvpltaekielgkvlffdprmsss
    gliscqtchnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqak
    gpvqagvemsntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitp
    nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
    agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
    qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1uC (C:)
    aidngalreeakgvfeaipekmtaikqpegvpltaekielgkvlffdprmsssgliscqt
    chnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqakgpvqagv
    sntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitpnsafdrfla
    gddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlpagdtgrfev
    trttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltdqqaeditaf
    lgtltgeqpvidhpilpvrtgttplptpm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c1uD (D:)
    eteaidngalreeakgvfeaipekmtaikqtednpegvpltaekielgkvlffdprmsss
    gliscqtchnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqak
    gpvqagvemsntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitp
    nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp
    agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd
    qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1uD (D:)
    aidngalreeakgvfeaipekmtaikqtpegvpltaekielgkvlffdprmsssgliscq
    tchnvglggvdglptsighgwqkgprnaptmlnaifnaaqfwdgraadlaeqakgpvqag
    vsntpdqvvktinsmpeyveafkaafpeeadpvtfdnfaaaieqfeatlitpnsafdrfl
    agddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgagrfevtrttdde
    yvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltdqqaeditaflgtltge
    qpvidhpilpvrtgttplptpm