![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Paracoccus pantotrophus [TaxId:82367] [187503] (3 PDB entries) |
![]() | Domain d2c1ud2: 2c1u D:181-338 [203698] automated match to d1nmla2 complexed with ca, hec |
PDB Entry: 2c1u (more details), 1.95 Å
SCOPe Domain Sequences for d2c1ud2:
Sequence, based on SEQRES records: (download)
>d2c1ud2 a.3.1.0 (D:181-338) automated matches {Paracoccus pantotrophus [TaxId: 82367]} nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgaevlp agdtgrfevtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltd qqaeditaflgtltgeqpvidhpilpvrtgttplptpm
>d2c1ud2 a.3.1.0 (D:181-338) automated matches {Paracoccus pantotrophus [TaxId: 82367]} nsafdrflagddaamtdqekrglqafmetgctachygvnfggqdyhpfgliakpgagrfe vtrttddeyvfraaplrnvaltapyfhsgvvwelaeavkimssaqigteltdqqaedita flgtltgeqpvidhpilpvrtgttplptpm
Timeline for d2c1ud2: