Lineage for d2c0oa1 (2c0o A:60-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783072Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2783073Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2783118Domain d2c0oa1: 2c0o A:60-120 [203670]
    Other proteins in same PDB: d2c0oa2, d2c0oa3, d2c0oa4, d2c0ob2, d2c0ob3, d2c0ob4
    automated match to d1qcfa1
    complexed with ca, l2g

Details for d2c0oa1

PDB Entry: 2c0o (more details), 2.85 Å

PDB Description: src family kinase hck with bound inhibitor a-770041
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d2c0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0oa1 b.34.2.1 (A:60-120) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d2c0oa1:

Click to download the PDB-style file with coordinates for d2c0oa1.
(The format of our PDB-style files is described here.)

Timeline for d2c0oa1: