Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56152] (25 PDB entries) |
Domain d2c0oa3: 2c0o A:224-505 [203672] Other proteins in same PDB: d2c0oa1, d2c0oa2, d2c0oa4, d2c0ob1, d2c0ob2, d2c0ob4 automated match to d1qcfa3 complexed with ca, l2g |
PDB Entry: 2c0o (more details), 2.85 Å
SCOPe Domain Sequences for d2c0oa3:
Sequence, based on SEQRES records: (download)
>d2c0oa3 d.144.1.7 (A:224-505) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip
>d2c0oa3 d.144.1.7 (A:224-505) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftik sdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknr peerptfeyiqsvlddfytatesqyeeip
Timeline for d2c0oa3:
View in 3D Domains from other chains: (mouse over for more information) d2c0ob1, d2c0ob2, d2c0ob3, d2c0ob4 |