Lineage for d2b7na2 (2b7n A:103-273)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575461Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 1575533Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 1575534Protein automated matches [226879] (6 species)
    not a true protein
  7. 1575543Species Helicobacter pylori [TaxId:210] [225051] (2 PDB entries)
  8. 1575544Domain d2b7na2: 2b7n A:103-273 [203562]
    Other proteins in same PDB: d2b7na1, d2b7nb1, d2b7nc1
    automated match to d1qapa1
    complexed with ntm, so4

Details for d2b7na2

PDB Entry: 2b7n (more details), 2.3 Å

PDB Description: crystal structure of quinolinic acid phosphoribosyltransferase from helicobacter pylori
PDB Compounds: (A:) Probable nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d2b7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7na2 c.1.17.0 (A:103-273) automated matches {Helicobacter pylori [TaxId: 210]}
iatltsrfvealnshkvrlldtrktrpllrifekysvlnggasnhrlglddalmlkdthl
rhvkdlksfltharknlpftakieiecesfeeaknamnagadivmcdnlsvletkeiaay
rdahypfvlleasgnislesinayaksgvdaisvgalihqatfidmhmkma

SCOPe Domain Coordinates for d2b7na2:

Click to download the PDB-style file with coordinates for d2b7na2.
(The format of our PDB-style files is described here.)

Timeline for d2b7na2: