SCOPe 2.08: Domain d2b7na2: 2b7n A:103-273

Lineage for d2b7na2 (2b7n A:103-273)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (8 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [225051] (2 PDB entries)

8. Domain d2b7na2: 2b7n A:103-273 [203562]
   Other proteins in same PDB: d2b7na1, d2b7nb1, d2b7nc1
   automated match to d1qapa1
   complexed with ntm, so4

Details for d2b7na2

PDB Entry: 2b7n, 2.3 Å

PDB Description: crystal structure of quinolinic acid phosphoribosyltransferase from helicobacter pylori

PDB Compounds: (A:) Probable nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d2b7na2:

Sequence; same for both SEQRES and ATOM records:

>d2b7na2 c.1.17.0 (A:103-273) automated matches {Helicobacter pylori [TaxId: 210]}
iatltsrfvealnshkvrlldtrktrpllrifekysvlnggasnhrlglddalmlkdthl
rhvkdlksfltharknlpftakieiecesfeeaknamnagadivmcdnlsvletkeiaay
rdahypfvlleasgnislesinayaksgvdaisvgalihqatfidmhmkma

Timeline for d2b7na2:

• d2b7na2 first appeared in SCOPe 2.03
  
• d2b7na2 appears in SCOPe 2.07