Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
Protein automated matches [226879] (8 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [225051] (2 PDB entries) |
Domain d2b7na2: 2b7n A:103-273 [203562] Other proteins in same PDB: d2b7na1, d2b7nb1, d2b7nc1 automated match to d1qapa1 complexed with ntm, so4 |
PDB Entry: 2b7n (more details), 2.3 Å
SCOPe Domain Sequences for d2b7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7na2 c.1.17.0 (A:103-273) automated matches {Helicobacter pylori [TaxId: 210]} iatltsrfvealnshkvrlldtrktrpllrifekysvlnggasnhrlglddalmlkdthl rhvkdlksfltharknlpftakieiecesfeeaknamnagadivmcdnlsvletkeiaay rdahypfvlleasgnislesinayaksgvdaisvgalihqatfidmhmkma
Timeline for d2b7na2:
View in 3D Domains from other chains: (mouse over for more information) d2b7nb1, d2b7nb2, d2b7nc1, d2b7nc2 |