Lineage for d2a92c2 (2a92 C:164-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2557023Species Plasmodium vivax [TaxId:5855] [225044] (3 PDB entries)
  8. 2557027Domain d2a92c2: 2a92 C:164-329 [203407]
    Other proteins in same PDB: d2a92a1, d2a92a3, d2a92b1, d2a92c1, d2a92c3, d2a92d1
    automated match to d1t26a2
    complexed with nai

Details for d2a92c2

PDB Entry: 2a92 (more details), 2.04 Å

PDB Description: crystal structure of lactate dehydrogenase from plasmodium vivax: complex with nadh
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a92c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a92c2 d.162.1.1 (C:164-329) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali

SCOPe Domain Coordinates for d2a92c2:

Click to download the PDB-style file with coordinates for d2a92c2.
(The format of our PDB-style files is described here.)

Timeline for d2a92c2: