PDB entry 2a92

View 2a92 on RCSB PDB site
Description: Crystal structure of lactate dehydrogenase from Plasmodium vivax: complex with NADH
Class: oxidoreductase
Keywords: rossmann fold, OXIDOREDUCTASE
Deposited on 2005-07-11, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
      • expression tag (315)
    Domains in SCOPe 2.07: d2a92a1, d2a92a2, d2a92a3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
    Domains in SCOPe 2.07: d2a92b1, d2a92b2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
      • expression tag (315-317)
    Domains in SCOPe 2.07: d2a92c1, d2a92c2, d2a92c3
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • GB AAY59419 (0-314)
    Domains in SCOPe 2.07: d2a92d1, d2a92d2
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a92A (A:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a92A (A:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a92B (B:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a92B (B:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkali
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a92C (C:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a92C (C:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a92D (D:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkalihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a92D (D:)
    tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
    tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
    iivvtnpvdvmvqllfehsgvpknkiiglggvldtsrlkyyisqklnvcprdvnalivga
    hgnkmvllkryitvggiplqefinnkkitdeevegifdrtvntaleivnllaspyvapaa
    aiiemaesylkdikkvlvcstllegqyghsnifggtplviggtgveqvielqlnaeektk
    fdeavaetkrmkali