| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (19 species) |
| Species Plasmodium vivax [TaxId:5855] [225043] (3 PDB entries) |
| Domain d2a92d1: 2a92 D:18-163 [203408] Other proteins in same PDB: d2a92a2, d2a92a3, d2a92b2, d2a92c2, d2a92c3, d2a92d2 automated match to d1t26a1 complexed with nai |
PDB Entry: 2a92 (more details), 2.04 Å
SCOPe Domain Sequences for d2a92d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a92d1 c.2.1.5 (D:18-163) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
iivvtnpvdvmvqllfehsgvpknkiigl
Timeline for d2a92d1: