Class a: All alpha proteins [46456] (285 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries) |
Domain d1x0xa2: 1x0x A:194-349 [203070] Other proteins in same PDB: d1x0xa1 automated match to d1evya1 complexed with nad, so4 |
PDB Entry: 1x0x (more details), 2.75 Å
SCOPe Domain Sequences for d1x0xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0xa2 a.100.1.0 (A:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk glvdkfplfmavykvcyegqpvgefihclqnhpehm
Timeline for d1x0xa2: