Lineage for d1x0xa2 (1x0x A:194-349)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329494Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2329495Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2329704Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2329705Protein automated matches [226851] (37 species)
    not a true protein
  7. 2329784Species Human (Homo sapiens) [TaxId:9606] [225061] (19 PDB entries)
  8. 2329839Domain d1x0xa2: 1x0x A:194-349 [203070]
    Other proteins in same PDB: d1x0xa1, d1x0xa3
    automated match to d1evya1
    complexed with nad, so4

Details for d1x0xa2

PDB Entry: 1x0x (more details), 2.75 Å

PDB Description: co-structure of homo sapiens glycerol-3-phosphate dehydrogenase 1 complex with nad
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1x0xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0xa2 a.100.1.0 (A:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk
glvdkfplfmavykvcyegqpvgefihclqnhpehm

SCOPe Domain Coordinates for d1x0xa2:

Click to download the PDB-style file with coordinates for d1x0xa2.
(The format of our PDB-style files is described here.)

Timeline for d1x0xa2: