Lineage for d1u3ia2 (1u3i A:85-211)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736229Protein automated matches [226848] (11 species)
    not a true protein
  7. 1736238Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [224992] (1 PDB entry)
  8. 1736239Domain d1u3ia2: 1u3i A:85-211 [202925]
    Other proteins in same PDB: d1u3ia1
    automated match to d2f8fa1
    complexed with gsh

Details for d1u3ia2

PDB Entry: 1u3i (more details), 1.89 Å

PDB Description: crystal structure of glutathione s-tranferase from schistosoma mansoni
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d1u3ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3ia2 a.45.1.1 (A:85-211) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mgetdeeyysvekligqaedveheyhktlmkpqeekekitkeilngkvpvlfnmiceslk
gstgklavgdkvtladlvliavidhvtdldkgfltgkypeihkhrenllassprlakyls
nrpatpf

SCOPe Domain Coordinates for d1u3ia2:

Click to download the PDB-style file with coordinates for d1u3ia2.
(The format of our PDB-style files is described here.)

Timeline for d1u3ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3ia1