SCOPe 2.05: Domain d1u3ia2: 1u3i A:85-211

Lineage for d1u3ia2 (1u3i A:85-211)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [224992] (1 PDB entry)

8. Domain d1u3ia2: 1u3i A:85-211 [202925]
   Other proteins in same PDB: d1u3ia1
   automated match to d2f8fa1
   complexed with gsh

Details for d1u3ia2

PDB Entry: 1u3i, 1.89 Å

PDB Description: crystal structure of glutathione s-tranferase from schistosoma mansoni

PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d1u3ia2:

Sequence; same for both SEQRES and ATOM records:

>d1u3ia2 a.45.1.1 (A:85-211) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mgetdeeyysvekligqaedveheyhktlmkpqeekekitkeilngkvpvlfnmiceslk
gstgklavgdkvtladlvliavidhvtdldkgfltgkypeihkhrenllassprlakyls
nrpatpf

Timeline for d1u3ia2:

• d1u3ia2 first appeared in SCOPe 2.03
  
• d1u3ia2 appears in SCOPe 2.04
  
• d1u3ia2 appears in SCOPe 2.06
  
• d1u3ia2 appears in the current release, SCOPe 2.08