![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (9 species) not a true protein |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [224992] (1 PDB entry) |
![]() | Domain d1u3ia2: 1u3i A:85-211 [202925] Other proteins in same PDB: d1u3ia1 automated match to d2f8fa1 complexed with gsh |
PDB Entry: 1u3i (more details), 1.89 Å
SCOPe Domain Sequences for d1u3ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ia2 a.45.1.1 (A:85-211) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} mgetdeeyysvekligqaedveheyhktlmkpqeekekitkeilngkvpvlfnmiceslk gstgklavgdkvtladlvliavidhvtdldkgfltgkypeihkhrenllassprlakyls nrpatpf
Timeline for d1u3ia2: