SCOPe 2.08: Domain d4jsqi_: 4jsq I:

Lineage for d4jsqi_ (4jsq I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4jsqi_: 4jsq I: [202761]
   Other proteins in same PDB: d4jsqb_, d4jsqc1, d4jsqc2, d4jsqd_, d4jsqe_, d4jsqf_, d4jsqg_, d4jsqh_, d4jsqk_, d4jsqp_, d4jsqq1, d4jsqq2, d4jsqr_, d4jsqs_, d4jsqt_, d4jsqu_, d4jsqv_, d4jsqy_
   automated match to d1g0ui_
   complexed with mes

Details for d4jsqi_

PDB Entry: 4jsq, 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4e

PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d4jsqi_:

Sequence; same for both SEQRES and ATOM records:

>d4jsqi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d4jsqi_:

• d4jsqi_ first appeared in SCOPe 2.03
  
• d4jsqi_ appears in SCOPe 2.07