SCOPe 2.08: Domain d4jsqc1: 4jsq C:1-234

Lineage for d4jsqc1 (4jsq C:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d4jsqc1: 4jsq C:1-234 [202757]
   Other proteins in same PDB: d4jsqa_, d4jsqc2, d4jsqe_, d4jsqi_, d4jsqj_, d4jsqk_, d4jsql_, d4jsqm_, d4jsqn_, d4jsqo_, d4jsqq2, d4jsqs_, d4jsqw_, d4jsqx_, d4jsqy_, d4jsqz_
   automated match to d2zcyc_
   complexed with mes

Details for d4jsqc1

PDB Entry: 4jsq, 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4e

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4jsqc1:

Sequence; same for both SEQRES and ATOM records:

>d4jsqc1 d.153.1.4 (C:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4jsqc1:

• d4jsqc1 first appeared in SCOPe 2.03, called d4jsqc_
  
• d4jsqc1 was called d4jsqc_ in SCOPe 2.07