SCOPe 2.04: Domain d4iwha_: 4iwh A:

Lineage for d4iwha_ (4iwh A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [193254] (1 PDB entry)

8. Domain d4iwha_: 4iwh A: [202678]
   automated match to d4iwhb_
   complexed with mg

Details for d4iwha_

PDB Entry: 4iwh, 1.75 Å

PDB Description: Crystal structure of a 3-isopropylmalate dehydrogenase from Burkholderia pseudomallei

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4iwha_:

Sequence; same for both SEQRES and ATOM records:

>d4iwha_ c.77.1.1 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
hhhmkiavlpgdgigpeivneavkvlnaldekfelehapvggagyeasghplpdatlala
keadailfgavgdwkydsleralrpeqailglrkhlelfanfrpaicypqlvdasplkpe
lvagldilivrelngdiyfgqprgvraapdgpfageregfdtmrysepevrriahvafqa
aqkrakkllsvdksnvletsqfwrdvmidvskeyadvelshmyvdnaamqlakapkqfdv
ivtgnmfgdilsdeasmltgsigmlpsasldknnkglyepshgsapdiagkgianplati
lsaamllryslnraeqadrieravktvleqgyrtgdiatpgcrqvgtaamgdavvaal

Timeline for d4iwha_:

• d4iwha_ first appeared in SCOPe 2.03
  
• d4iwha_ appears in SCOPe 2.05
  
• d4iwha_ appears in the current release, SCOPe 2.08, called d4iwha1