Lineage for d4iwha1 (4iwh A:1-355)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906035Species Burkholderia thailandensis [TaxId:271848] [193254] (1 PDB entry)
  8. 2906036Domain d4iwha1: 4iwh A:1-355 [202678]
    Other proteins in same PDB: d4iwha2
    automated match to d4iwhb_
    complexed with mg

Details for d4iwha1

PDB Entry: 4iwh (more details), 1.75 Å

PDB Description: Crystal structure of a 3-isopropylmalate dehydrogenase from Burkholderia pseudomallei
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4iwha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iwha1 c.77.1.1 (A:1-355) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkiavlpgdgigpeivneavkvlnaldekfelehapvggagyeasghplpdatlalakea
dailfgavgdwkydsleralrpeqailglrkhlelfanfrpaicypqlvdasplkpelva
gldilivrelngdiyfgqprgvraapdgpfageregfdtmrysepevrriahvafqaaqk
rakkllsvdksnvletsqfwrdvmidvskeyadvelshmyvdnaamqlakapkqfdvivt
gnmfgdilsdeasmltgsigmlpsasldknnkglyepshgsapdiagkgianplatilsa
amllryslnraeqadrieravktvleqgyrtgdiatpgcrqvgtaamgdavvaal

SCOPe Domain Coordinates for d4iwha1:

Click to download the PDB-style file with coordinates for d4iwha1.
(The format of our PDB-style files is described here.)

Timeline for d4iwha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iwha2
View in 3D
Domains from other chains:
(mouse over for more information)
d4iwhb_