SCOPe 2.05: Domain d4h15c_: 4h15 C:

Lineage for d4h15c_ (4h15 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [189876] (11 PDB entries)

8. Domain d4h15c_: 4h15 C: [202350]
   automated match to d4h15d_
   complexed with ca, cl, mpd

Details for d4h15c_

PDB Entry: 4h15, 1.45 Å

PDB Description: Crystal Structure of a short chain alcohol dehydrogenase-related dehydrogenase (target ID NYSGRC-011812) from Sinorhizobium meliloti 1021 in space group P21

PDB Compounds: (C:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d4h15c_:

Sequence; same for both SEQRES and ATOM records:

>d4h15c_ c.2.1.0 (C:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
smmieflnlrgkralitagtkgagaatvslflelgaqvlttararpeglpeelfveadlt
tkegcaivaeatrqrlggvdvivhmlggssaagggfsalsdddwynelslnlfaavrldr
qlvpdmvargsgvvvhvtsiqrvlplpesttayaaakaalstyskamskevspkgvrvvr
vspgwieteasvrlaerlakqagtdleggkkiimdglggiplgrpakpeevanliaflas
draasitgaeytidggtvpta

Timeline for d4h15c_:

• d4h15c_ first appeared in SCOPe 2.03
  
• d4h15c_ appears in SCOPe 2.04
  
• d4h15c_ is called d4h15c1 in SCOPe 2.06
  
• d4h15c_ appears in the current release, SCOPe 2.08, called d4h15c1