| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Sinorhizobium meliloti [TaxId:266834] [189876] (13 PDB entries) |
| Domain d4h15c1: 4h15 C:1-259 [202350] Other proteins in same PDB: d4h15a2, d4h15b2, d4h15c2, d4h15d2 automated match to d4h15d_ complexed with ca, cl, mpd |
PDB Entry: 4h15 (more details), 1.45 Å
SCOPe Domain Sequences for d4h15c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h15c1 c.2.1.0 (C:1-259) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mieflnlrgkralitagtkgagaatvslflelgaqvlttararpeglpeelfveadlttk
egcaivaeatrqrlggvdvivhmlggssaagggfsalsdddwynelslnlfaavrldrql
vpdmvargsgvvvhvtsiqrvlplpesttayaaakaalstyskamskevspkgvrvvrvs
pgwieteasvrlaerlakqagtdleggkkiimdglggiplgrpakpeevanliaflasdr
aasitgaeytidggtvpta
Timeline for d4h15c1: