SCOPe 2.06: Domain d4h15c1: 4h15 C:1-259

Lineage for d4h15c1 (4h15 C:1-259)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [189876] (11 PDB entries)

8. Domain d4h15c1: 4h15 C:1-259 [202350]
   Other proteins in same PDB: d4h15a2, d4h15b2, d4h15c2, d4h15d2
   automated match to d4h15d_
   complexed with ca, cl, mpd

Details for d4h15c1

PDB Entry: 4h15, 1.45 Å

PDB Description: Crystal Structure of a short chain alcohol dehydrogenase-related dehydrogenase (target ID NYSGRC-011812) from Sinorhizobium meliloti 1021 in space group P21

PDB Compounds: (C:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d4h15c1:

Sequence; same for both SEQRES and ATOM records:

>d4h15c1 c.2.1.0 (C:1-259) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mieflnlrgkralitagtkgagaatvslflelgaqvlttararpeglpeelfveadlttk
egcaivaeatrqrlggvdvivhmlggssaagggfsalsdddwynelslnlfaavrldrql
vpdmvargsgvvvhvtsiqrvlplpesttayaaakaalstyskamskevspkgvrvvrvs
pgwieteasvrlaerlakqagtdleggkkiimdglggiplgrpakpeevanliaflasdr
aasitgaeytidggtvpta

Timeline for d4h15c1:

• d4h15c1 first appeared in SCOPe 2.03, called d4h15c_
  
• d4h15c1 was called d4h15c_ in SCOPe 2.05
  
• d4h15c1 appears in SCOPe 2.07
  
• d4h15c1 appears in the current release, SCOPe 2.08