![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein automated matches [190531] (16 species) not a true protein |
![]() | Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries) |
![]() | Domain d4h0md_: 4h0m D: [202326] automated match to d4h0mp_ complexed with cyc |
PDB Entry: 4h0m (more details), 2.2 Å
SCOPe Domain Sequences for d4h0md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0md_ a.1.1.3 (D:) automated matches {Synechococcus elongatus [TaxId: 1140]} tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava
Timeline for d4h0md_: