Lineage for d4h0mj_ (4h0m J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718294Protein automated matches [190531] (16 species)
    not a true protein
  7. 1718436Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)
  8. 1718446Domain d4h0mj_: 4h0m J: [202331]
    automated match to d4h0mp_
    complexed with cyc

Details for d4h0mj_

PDB Entry: 4h0m (more details), 2.2 Å

PDB Description: X-Ray Crystal Structure of Phycocyanin from Synechococcus elongatus sp. PCC 7942
PDB Compounds: (J:) C-phycocyanin beta chain

SCOPe Domain Sequences for d4h0mj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0mj_ a.1.1.3 (J:) automated matches {Synechococcus elongatus [TaxId: 1140]}
tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava

SCOPe Domain Coordinates for d4h0mj_:

Click to download the PDB-style file with coordinates for d4h0mj_.
(The format of our PDB-style files is described here.)

Timeline for d4h0mj_: