Lineage for d4fcmb_ (4fcm B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641515Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1641516Protein automated matches [190205] (19 species)
    not a true protein
  7. 1641542Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)
  8. 1641548Domain d4fcmb_: 4fcm B: [202028]
    automated match to d4fcma_
    complexed with po4

Details for d4fcmb_

PDB Entry: 4fcm (more details), 2.69 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide
PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcmb_:

Sequence, based on SEQRES records: (download)

>d4fcmb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke
ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv
ankfyvhndifryqdevf

Sequence, based on observed residues (ATOM records): (download)

>d4fcmb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldkpadavygqkeihr
kvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvank
fyvhndifryqdevf

SCOPe Domain Coordinates for d4fcmb_:

Click to download the PDB-style file with coordinates for d4fcmb_.
(The format of our PDB-style files is described here.)

Timeline for d4fcmb_: