| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (19 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries) |
| Domain d4fcma_: 4fcm A: [197234] automated match to d3q90b_ complexed with po4 |
PDB Entry: 4fcm (more details), 2.69 Å
SCOPe Domain Sequences for d4fcma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fcma_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrkvm
sqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyv
hndifryqdevf
Timeline for d4fcma_: