Lineage for d4fcma_ (4fcm A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896937Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1896938Protein automated matches [190205] (21 species)
    not a true protein
  7. 1896964Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)
  8. 1896969Domain d4fcma_: 4fcm A: [197234]
    automated match to d3q90b_
    complexed with po4

Details for d4fcma_

PDB Entry: 4fcm (more details), 2.69 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide
PDB Compounds: (A:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fcma_ d.17.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqkeihrkvm
sqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvankfyv
hndifryqdevf

SCOPe Domain Coordinates for d4fcma_:

Click to download the PDB-style file with coordinates for d4fcma_.
(The format of our PDB-style files is described here.)

Timeline for d4fcma_: