SCOPe 2.08: Domain d4fcmb_: 4fcm B:

Lineage for d4fcmb_ (4fcm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries)

8. Domain d4fcmb_: 4fcm B: [202028]
   automated match to d4fcma_
   complexed with po4

Details for d4fcmb_

PDB Entry: 4fcm, 2.69 Å

PDB Description: crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide

PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d4fcmb_:

Sequence, based on SEQRES records:

>d4fcmb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke
ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv
ankfyvhndifryqdevf

Sequence, based on observed residues (ATOM records):

>d4fcmb_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldkpadavygqkeihr
kvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsvank
fyvhndifryqdevf

Timeline for d4fcmb_:

• d4fcmb_ first appeared in SCOPe 2.03
  
• d4fcmb_ appears in SCOPe 2.07