Lineage for d4akzd_ (4akz D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641455Family d.17.4.26: VirB8-like [160029] (2 proteins)
    Pfam PF04335
  6. 1641456Protein Type IV secretion system protein VirB8 [160030] (2 species)
  7. 1641459Species Brucella melitensis [TaxId:29459] [160032] (3 PDB entries)
    Uniprot Q7CEG3 97-235
  8. 1641463Domain d4akzd_: 4akz D: [201445]
    automated match to d4akya_

Details for d4akzd_

PDB Entry: 4akz (more details), 2.25 Å

PDB Description: crystal structure of virb8 from brucella suis
PDB Compounds: (D:) type IV secretion system protein virb8

SCOPe Domain Sequences for d4akzd_:

Sequence, based on SEQRES records: (download)

>d4akzd_ d.17.4.26 (D:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpe

Sequence, based on observed residues (ATOM records): (download)

>d4akzd_ d.17.4.26 (D:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtgetthwiatigyqyvnpslmsesarltnp
lgfnvtsyrvdpe

SCOPe Domain Coordinates for d4akzd_:

Click to download the PDB-style file with coordinates for d4akzd_.
(The format of our PDB-style files is described here.)

Timeline for d4akzd_: