| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.26: VirB8-like [160029] (2 proteins) Pfam PF04335 |
| Protein Type IV secretion system protein VirB8 [160030] (2 species) |
| Species Brucella melitensis [TaxId:29459] [160032] (3 PDB entries) Uniprot Q7CEG3 97-235 |
| Domain d4akza_: 4akz A: [193542] automated match to d2bhma1 |
PDB Entry: 4akz (more details), 2.25 Å
SCOPe Domain Sequences for d4akza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akza_ d.17.4.26 (A:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpe
Timeline for d4akza_:
View in 3DDomains from other chains: (mouse over for more information) d4akzb_, d4akzc_, d4akzd_, d4akze_ |