SCOPe 2.07: Domain d4ac7c2: 4ac7 C:132-434,C:484-570

Lineage for d4ac7c2 (4ac7 C:132-434,C:484-570)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)

6. Protein alpha-subunit of urease, catalytic domain [51561] (4 species)

7. Species Bacillus pasteurii [TaxId:1474] [51563] (9 PDB entries)

8. Domain d4ac7c2: 4ac7 C:132-434,C:484-570 [201415]
   Other proteins in same PDB: d4ac7a_, d4ac7b_, d4ac7c1
   automated match to d4ubpc2
   complexed with edo, flc, ni, oh, so4

Details for d4ac7c2

PDB Entry: 4ac7, 1.5 Å

PDB Description: the crystal structure of sporosarcina pasteurii urease in complex with citrate

PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4ac7c2:

Sequence; same for both SEQRES and ATOM records:

>d4ac7c2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

Timeline for d4ac7c2:

• d4ac7c2 first appeared in SCOPe 2.03
  
• d4ac7c2 appears in SCOPe 2.06
  
• d4ac7c2 appears in the current release, SCOPe 2.08