Lineage for d4ac7b_ (4ac7 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427322Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2427323Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2427381Protein automated matches [192998] (2 species)
    not a true protein
  7. 2427407Species Sporosarcina pasteurii [TaxId:1474] [193000] (2 PDB entries)
  8. 2427408Domain d4ac7b_: 4ac7 B: [193003]
    Other proteins in same PDB: d4ac7a_, d4ac7c1, d4ac7c2
    automated match to d4ubpb_
    complexed with edo, flc, ni, oh, so4

Details for d4ac7b_

PDB Entry: 4ac7 (more details), 1.5 Å

PDB Description: the crystal structure of sporosarcina pasteurii urease in complex with citrate
PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4ac7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac7b_ b.85.3.1 (B:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d4ac7b_:

Click to download the PDB-style file with coordinates for d4ac7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ac7b_: