![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
![]() | Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
![]() | Protein Urease, gamma-subunit [54113] (4 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries) |
![]() | Domain d4ac7a_: 4ac7 A: [192590] Other proteins in same PDB: d4ac7b_, d4ac7c1, d4ac7c2 automated match to d4ubpa_ complexed with edo, flc, ni, oh, so4 |
PDB Entry: 4ac7 (more details), 1.5 Å
SCOPe Domain Sequences for d4ac7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ac7a_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d4ac7a_: